BDKRB1 Antibody - C-terminal region (ARP65156_P050)

Catalog No: ARP65156_P050

Host: Rabbit
Target Name: BDKRB1
Antibody Dilution: 1.0ug/ml
Sample Type: HT1080 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rabbit: 77%
• Peptide Sequence: Synthetic peptide located within the following region: NFFAFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BDKRB1 (ARP65156_P050) antibody is Catalog # AAP65156

Target Info

• Gene Symbol: BDKRB1
• Gene Full Name: Bradykinin receptor B1
• Alias Symbols: B1R, BKR1, B1BKR, BKB1R, BRADYB1
• NCBI Gene Id: 623
• Protein Name: B1 bradykinin receptor
• Description of Target: Bradykinin, a 9 aa peptide, is generated in pathophysiologic conditions such as inflammation, trauma, burns, shock, and allergy. Two types of G-protein coupled receptors have been found which bind bradykinin and mediate responses to these pathophysiologic conditions. The protein encoded by this gene is one of these receptors and is synthesized de novo following tissue injury. Receptor binding leads to an increase in the cytosolic calcium ion concentration, ultimately resulting in chronic and acute inflammatory responses. Several transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: P46663
• Protein Accession #: NP_000701
• Nucleotide Accession #: NM_000710
• Protein Size (# AA): 353
• Molecular Weight: 40kDa
• Protein Interactions: GNAQ; MEP1A;