website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

SMARCA5 antibody - N-terminal region (ARP30031_P050)

Description of Target:
SMARCA5 is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA5 is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II.The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
SMARCA5
Official Gene Full Name:
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
Alias Symbols:
ISWI; SNF2H; WCRF135; hISWI; hSNF2H
Tissue Tool:
Find tissues and cell lines supported to express SMARCA5.
Protein Accession# :
NP_003592
Nucleotide Accession#:
NM_003601
Swissprot Id:
O60264
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
1052
Molecular Weight:
122kDa
Application:
WB
Immunogen:
The immunogen for anti-SMARCA5 antibody: synthetic peptide directed towards the N terminal of human SMARCA5
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
SMARCA5 antibody - N-terminal region (ARP30031_P050)
Predicted Homology Based on Immunogen Sequence:
Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 85%
Datasheets / Downloads:
Printable datasheet for
anti-SMARCA5 antibody
- ARP30031_P050
Peptide Sequence:
Synthetic peptide located within the following region: AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE
Blocking Peptide:
For anti-SMARCA5 antibody is Catalog # AAP30031 (Previous Catalog # AAPH00207)
Key Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-SMARCA5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: SMARCA5 antibody tested with Human Transfected 293T Cells (ARP30031_P050)

Aviva Systems Biology is the original manufacturer of this SMARCA5 antibody (ARP30031_P050)

Click here to view the SMARCA5 antibody Western Blot Protocol

Product Datasheet Link: SMARCA5 antibody (ARP30031_P050)

WB Suggested Anti-SMARCA5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Western Blot image:


Description of Target: SMARCA5 is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA5 is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II.The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SMARCA5 antibody (ARP30031_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com