SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP45036_P050
Price: $0.00
SKU
ARP45036_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-AADAC (ARP45036_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AADAC
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 91%; Rabbit: 100%; Rat: 90%
Peptide SequenceSynthetic peptide located within the following region: AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFN
Concentration0.5 mg/ml
Blocking PeptideFor anti-AADAC (ARP45036_P050) antibody is Catalog # AAP45036 (Previous Catalog # AAPP12324)
ReferenceFrick,C., (2004) J. Biol. Chem. 279 (30), 31131-31138
Gene SymbolAADAC
Gene Full NameArylacetamide deacetylase (esterase)
Alias SymbolsDAC, CES5A1
NCBI Gene Id13
Protein NameArylacetamide deacetylase
Description of TargetMicrosomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-5 AV705031.1 1-5 6-247 L32179.1 1-242 248-1725 BC032309.1 183-1660
Uniprot IDP22760
Protein Accession #NP_001077
Nucleotide Accession #NM_001086
Protein Size (# AA)399
Molecular Weight46kDa
  1. What is the species homology for "AADAC Antibody - N-terminal region (ARP45036_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "AADAC Antibody - N-terminal region (ARP45036_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AADAC Antibody - N-terminal region (ARP45036_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AADAC Antibody - N-terminal region (ARP45036_P050)"?

    This target may also be called "DAC, CES5A1" in publications.

  5. What is the shipping cost for "AADAC Antibody - N-terminal region (ARP45036_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AADAC Antibody - N-terminal region (ARP45036_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AADAC Antibody - N-terminal region (ARP45036_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AADAC Antibody - N-terminal region (ARP45036_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AADAC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AADAC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AADAC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AADAC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AADAC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AADAC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AADAC Antibody - N-terminal region (ARP45036_P050)
Your Rating
We found other products you might like!