USP18 Antibody - N-terminal region (ARP46253_P050)

Catalog No: ARP46253_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human USP18
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-USP18 (ARP46253_P050) antibody is Catalog # AAP46253 (Previous Catalog # AAPP27083)
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Yan,M., (2007) Blood 110 (1), 305-312

Target Info

• Gene Symbol: USP18
• Gene Full Name: Ubiquitin specific peptidase 18
• Alias Symbols: ISG43, UBP43, PTORCH2
• NCBI Gene Id: 11274
• Protein Name: Ubl carboxyl-terminal hydrolase 18
• Description of Target: USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-232 AC008079.24 80964-81195 233-495 AC008079.24 88531-88793 496-592 AC008079.24 91145-91241 593-738 AC008079.24 92763-92908 739-818 AC008079.24 98228-98307 819-965 AC008079.24 98863-99009 966-1061 AC008079.24 100817-100912 1062-1229 AC008079.24 101726-101893 1230-1361 AC008079.24 104123-104254 1362-1411 AC008079.24 104766-104815 1412-2037 AC008079.24 107745-108370
• Uniprot ID: Q9UMW8
• Protein Accession #: NP_059110
• Nucleotide Accession #: NM_017414
• Protein Size (# AA): 372
• Molecular Weight: 43 kDa
• Protein Interactions: ISG15; UBC; SKP2; PCNA; TRIM54; IFNAR2; USP41; KDM3B; NME1; MYL6;