Uchl3 Antibody - middle region (ARP59298_P050)

Catalog No: ARP59298_P050

Host: Rabbit
Target Name: Uchl3
Sample Type: Mouse Testis lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Uchl3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%
• Peptide Sequence: Synthetic peptide located within the following region: IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHET
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Uchl3 (ARP59298_P050) antibody is Catalog # AAP59298

Target Info

• Gene Symbol: Uchl3
• Gene Full Name: ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
• Alias Symbols: -
• NCBI Gene Id: 50933
• Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L3
• Description of Target: Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Uchl3 has a 10-fold preference for Arg and Lys at position P3", and exhibits a preference towards 'Lys-48'-linked Ubiquitin chains. Uchl3 deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Uchl3 indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. It is required for stress-response retinal, skeletal muscle and germ cell maintenance. Uchl3 may be involved in working memory and can hydrolyze UBB(+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome.
• Uniprot ID: Q9JKB1
• Protein Accession #: NP_057932
• Nucleotide Accession #: NM_016723
• Protein Size (# AA): 230
• Molecular Weight: 26kDa
• Protein Interactions: Nedd8;