UBE2Q2 Antibody - middle region (ARP66117_P050)

Catalog No: ARP66117_P050

WB Suggested Anti-UBE2Q2 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human UBE2Q2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: EDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UBE2Q2 (ARP66117_P050) antibody is Catalog # AAP66117

Target Info

• Gene Symbol: UBE2Q2
• Alias Symbols: DKFZp762C143
• NCBI Gene Id: 92912
• Protein Name: Ubiquitin-conjugating enzyme E2 Q2
• Description of Target: UBE2Q2 accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro UBE2Q2 catalyzes 'Lys-48'-linked polyubiquitination.
• Uniprot ID: Q8WVN8
• Protein Accession #: NP_775740
• Nucleotide Accession #: NM_173469
• Protein Size (# AA): 375
• Molecular Weight: 43kDa
• Protein Interactions: UBE2Q2; WDR77; PRMT5; ARPC2; ARPC4; MYO1C; GSN; DBN1; CAPZB; ACTG1; ELAVL1; UBC; BIRC3; BIRC2; RNF111; PCGF2;