UBE2Q1 Antibody - middle region (ARP62942_P050)

Catalog No: ARP62942_P050

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. An isoform present at 28 kDa contains the peptide sequence.

WB Suggested Anti-UBE2Q1 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Lung

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Yeast: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PLPAEQCTQEDVSSEDEDEEMPEDTEDLDHYEMKEEEPAEGKKSEDDGIG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UBE2Q1 (ARP62942_P050) antibody is Catalog # AAP62942
• Enhanced Validation:

  Relative Expression (Western Blot)

Target Info

• Gene Symbol: UBE2Q1
• Gene Full Name: Ubiquitin-conjugating enzyme E2Q family member 1
• Alias Symbols: GTAP, NICE5, UBE2Q, NICE-5, PRO3094
• NCBI Gene Id: 55585
• Protein Name: Ubiquitin-conjugating enzyme E2 Q1
• Description of Target: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s), and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is 98% identical to the mouse counterpart.
• Uniprot ID: Q7Z7E8
• Protein Accession #: NP_060052
• Nucleotide Accession #: NM_017582
• Protein Size (# AA): 422
• Molecular Weight: 46 kDa
• Protein Interactions: STUB1; FHL3; UBC; KIAA0368; RNF26; IRF2BPL; RNF7;