Sumo1 antibody - N-terminal region (ARP30639_P050)

Catalog#: ARP30639_P050

• Size: 50ug

Mouse Thymus

• Description of Target: Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. It is involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. It may also regulate a network of genes involved in palate development.
• Gene Symbol: Sumo1
• Official Gene Full Name: SMT3 suppressor of mif two 3 homolog 1 (yeast)
• Alias Symbols: GMP1; MGC103203; PIC1; SENTRIN; SMT3; SMT3H3; SMTP3; SUMO-1; Smt3C; Ubl1
• Protein Accession#: NP_033486
• Nucleotide Accession#: NM_009460
• Swissprot Id: P63166
• Host: Rabbit
• Protein Size (# AA): 101
• Molecular Weight: 11kDa
• Application: WB
• Partner Proteins: Jun,Junb,Hif1a,Nfkb2,Pou5f1
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Goat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYC
• Blocking Peptide: For anti-Sumo1 antibody is Catalog # AAP30639 (Previous Catalog # AAPP01292)
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-Sumo1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.