SENP5 Antibody - middle region (ARP55489_P050)

Catalog No: ARP55489_P050

WB Suggested Anti-SENP5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Sample Type: 1.Rat Testis cells (200ug) 
Primary Dilution: 1:1000
Secondary Antibody: alkaline phosphatase-conjugated anti-rabbit
Secondary Dilution: 1:1000
Image Submitted by: Andreia Carvalho
IBMC-OBF, Portugal See Customer Feedback tab for detailed information.

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SENP5 (ARP55489_P050) antibody is Catalog # AAP55489 (Previous Catalog # AAPP33381)
• Reference: Gong,L. (2006) J. Biol. Chem. 281 (23), 15869-15877

Target Info

• Gene Symbol: SENP5
• Gene Full Name: SUMO1/sentrin specific peptidase 5
• Alias Symbols: DKFZp564O1016, FLJ42398, MGC27076
• NCBI Gene Id: 205564
• Protein Name: Sentrin-specific protease 5
• Description of Target: The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.
• Uniprot ID: Q96HI0
• Protein Accession #: NP_689912
• Nucleotide Accession #: NM_152699
• Protein Size (# AA): 755
• Molecular Weight: 87kDa
• Protein Interactions: RABGAP1; SUMO3; PASK; SUMO2;