PLEKHG2 Antibody - middle region (ARP59650_P050)

Catalog No: ARP59650_P050

WB Suggested Anti-PLEKHG2 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLEKHG2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPAKAKQVLLENS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PLEKHG2 (ARP59650_P050) antibody is Catalog # AAP59650 (Previous Catalog # AAPP45826)

Target Info

• Gene Symbol: PLEKHG2
• Gene Full Name: Pleckstrin homology domain containing, family G (with RhoGef domain) member 2
• Alias Symbols: CLG, LDAMD, ARHGEF42, CTB-60E11.4
• NCBI Gene Id: 64857
• Protein Name: Pleckstrin homology domain-containing family G member 2
• Description of Target: PLEKHG2 may be a transforming oncogene with exchange activity for CDC42. PLEKHG2 may be a guanine-nucleotide exchange factor (GEF) for RAC1 and CDC42.PLEKHG2 activated by the binding to subunits beta and gamma of the heterotrimeric guanine nucleotide-binding protein (G protein).
• Uniprot ID: Q9H7P9
• Protein Accession #: NP_073746
• Nucleotide Accession #: NM_022835
• Protein Size (# AA): 1344
• Molecular Weight: 144kDa
• Protein Interactions: ACTN3; XRN1; APP; GNG2; GNB1; RAC1; RHOA; CDC42;