SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP30587_P050
Price: $0.00
SKU
ARP30587_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-OAS1 (ARP30587_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
Concentration0.5 mg/ml
Blocking PeptideFor anti-OAS1 (ARP30587_P050) antibody is Catalog # AAP30587
Sample Type Confirmation

OAS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, MCF7

Publications

Li, Q. & Tainsky, M. A. Higher miRNA tolerance in immortal Li-Fraumeni fibroblasts with abrogated interferon signaling pathway. Cancer Res. 71, 255-65 (2011). 21199806

Gene SymbolOAS1
Gene Full Name2'-5'-oligoadenylate synthetase 1, 40/46kDa
Alias SymbolsOIAS, IFI-4, OIASI, E18/E16
NCBI Gene Id4938
Protein Name2'-5'-oligoadenylate synthase 1
Description of TargetOAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.
Uniprot IDP00973
Protein Accession #NP_058132
Nucleotide Accession #NM_016816
Protein Size (# AA)400
Molecular Weight46kDa
Protein InteractionsEXOC5; TRIM27; ACTN1; PRMT6; WBSCR22; RPL30; HCVgp1;
  1. What is the species homology for "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "OAS1 Antibody - C-terminal region (ARP30587_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    This target may also be called "OIAS, IFI-4, OIASI, E18/E16" in publications.

  5. What is the shipping cost for "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "OAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "OAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "OAS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "OAS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "OAS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "OAS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:OAS1 Antibody - C-terminal region (ARP30587_P050)
Your Rating
We found other products you might like!