website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

OAS1 antibody - C-terminal region (ARP30587_P050)

Description of Target:
OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.
Gene Symbol:
OAS1
Official Gene Full Name:
2'-5'-oligoadenylate synthetase 1, 40/46kDa
NCBI Gene Id:
4938
Alias Symbols:
IFI-4; OIAS; OIASI
Sample Type Confirmation:

OAS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, MCF7

Tissue Tool:
Find tissues and cell lines supported to express OAS1.
Protein Accession #:
NP_058132
Nucleotide Accession#:
NM_016816
Swissprot Id:
P00973
Host:
Rabbit
Protein Name:
2'-5'-oligoadenylate synthase 1
Protein Size (# AA):
400
Molecular Weight:
46kDa
Application:
IHC, WB
Product Format:
Lyophilized powder
Complete computational species homology data:
OAS1 antibody - C-terminal region (ARP30587_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for
anti-OAS1 antibody
- ARP30587_P050
Peptide Sequence:
Synthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
Blocking Peptide:
For anti-OAS1 antibody is Catalog # AAP30587
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-OAS1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question