website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

OAS1 antibody - C-terminal region (ARP30587_P050)

Description of Target:
OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.
Gene Symbol:
OAS1
Official Gene Full Name:
2'-5'-oligoadenylate synthetase 1, 40/46kDa
NCBI Gene Id:
4938
Alias Symbols:
IFI-4; OIAS; OIASI
Sample Type Confirmation:

OAS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, MCF7

Tissue Tool:
Find tissues and cell lines supported to express OAS1.
Protein Accession #:
NP_058132
Nucleotide Accession#:
NM_016816
Swissprot Id:
P00973
Host:
Rabbit
Protein Name:
2'-5'-oligoadenylate synthase 1
Protein Size (# AA):
400
Molecular Weight:
46kDa
Application:
IHC, WB
Product Format:
Lyophilized powder
Complete computational species homology data:
OAS1 antibody - C-terminal region (ARP30587_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for
anti-OAS1 antibody
- ARP30587_P050
Peptide Sequence:
Synthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
Blocking Peptide:
For anti-OAS1 antibody is Catalog # AAP30587
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-OAS1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Publications:

Anti-OAS1 ARP30587_P050 has recently been referenced in the following publications:

Li, Q. & Tainsky, M. A. Higher miRNA tolerance in immortal Li-Fraumeni fibroblasts with abrogated interferon signaling pathway. Cancer Res. 71, 255–65 (2011). WB, IHC, Human 21199806

Computational species homology for OAS1 antibody (ARP30587)

Product page for OAS1 antibody (ARP30587)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Human OAS1 antibody; Homo sapiens OAS1 antibody P00973 100%
Human OAS1 antibody; Homo sapiens OAS1 antibody C6EMZ7 100%
Lowland gorilla OAS1 antibody; Gorilla gorilla gorilla OAS1 antibody G3SFB1 100%
Pygmy chimpanzee OAS1 antibody; Pan paniscus OAS1 antibody B6RC74 100%
Pygmy chimpanzee OAS1 antibody; Pan paniscus OAS1 antibody B6RC68 100%
western gorilla OAS1 antibody; Gorilla gorilla OAS1 antibody A0MVT8 100%
 
X
Ask a Question