website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

OAS1 antibody - C-terminal region (ARP30587_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    OAS1
    NCBI Gene Id:
    4938
    Official Gene Full Name:
    2'-5'-oligoadenylate synthetase 1, 40/46kDa
    Protein Name:
    2'-5'-oligoadenylate synthase 1
    Swissprot Id:
    P00973
    Protein Accession #:
    NP_058132
    Nucleotide Accession #:
    NM_016816
    Alias Symbols:
    IFI-4, OIAS, OIASI
    Description of Target:
    OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.
    Protein Size (# AA):
    400
    Molecular Weight:
    46kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express OAS1.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express OAS1.
    Species Reactivity:
    Human
    Predicted Homology Based on Immunogen Sequence:
    Human: 100%
    Complete computational species homology data:
    Anti-OAS1 (ARP30587_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    EXOC5; TRIM27; ACTN1; PRMT6; WBSCR22; RPL30; HCVgp1;
    Blocking Peptide:
    For anti-OAS1 (ARP30587_P050) antibody is Catalog # AAP30587
    Datasheets / Downloads:
    Printable datasheet for anti-OAS1 (ARP30587_P050) antibody
    Sample Type Confirmation:

    OAS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, MCF7

    Publications:

    Li, Q. & Tainsky, M. A. Higher miRNA tolerance in immortal Li-Fraumeni fibroblasts with abrogated interferon signaling pathway. Cancer Res. 71, 255-65 (2011). WB, IHC, Human 21199806

     
    X
    Ask a Question