website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

OAS1 antibody - C-terminal region (ARP30587_P050)

Description of Target:
OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.
Gene Symbol:
OAS1
Official Gene Full Name:
2'-5'-oligoadenylate synthetase 1, 40/46kDa
NCBI Gene Id:
4938
Alias Symbols:
IFI-4; OIAS; OIASI
Sample Type Confirmation:

OAS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, MCF7

Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OAS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OAS1.
Swissprot Id:
P00973
Protein Accession #:
NP_058132
Nucleotide Accession #:
NM_016816
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
2'-5'-oligoadenylate synthase 1
Protein Size (# AA):
400
Molecular Weight:
46kDa
Application:
IHC, WB
Protein Interactions:
EXOC5; TRIM27; ACTN1; PRMT6; WBSCR22; RPL30; HCVgp1;
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-OAS1 (ARP30587_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for anti-OAS1 (ARP30587_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
Blocking Peptide:
For anti-OAS1 (ARP30587_P050) antibody is Catalog # AAP30587
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Publications:

Li, Q. & Tainsky, M. A. Higher miRNA tolerance in immortal Li-Fraumeni fibroblasts with abrogated interferon signaling pathway. Cancer Res. 71, 255-65 (2011). WB, IHC, Human 21199806

 
X
Ask a Question