website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

OAS1 antibody - C-terminal region (ARP30587_P050)

Description of Target:
OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.
Gene Symbol:
Official Gene Full Name:
2'-5'-oligoadenylate synthetase 1, 40/46kDa
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

OAS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, MCF7

Tissue Tool:
Find tissues and cell lines supported to express OAS1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
2'-5'-oligoadenylate synthase 1
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
OAS1 antibody - C-terminal region (ARP30587_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-OAS1 antibody
- ARP30587_P050
Peptide Sequence:
Synthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
Blocking Peptide:
For anti-OAS1 antibody is Catalog # AAP30587
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Li, Q. & Tainsky, M. A. Higher miRNA tolerance in immortal Li-Fraumeni fibroblasts with abrogated interferon signaling pathway. Cancer Res. 71, 255-65 (2011). WB, IHC, Human 21199806

Ask a Question