website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

OAS1 antibody - C-terminal region (ARP30587_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
$289.00
In Stock

Conjugation Options

ARP30587_P050-FITC Conjugated

ARP30587_P050-HRP Conjugated

ARP30587_P050-Biotin Conjugated

Gene Symbol:
OAS1
NCBI Gene Id:
4938
Official Gene Full Name:
2'-5'-oligoadenylate synthetase 1, 40/46kDa
Protein Name:
2'-5'-oligoadenylate synthase 1
Swissprot Id:
P00973
Protein Accession #:
NP_058132
Nucleotide Accession #:
NM_016816
Alias Symbols:
IFI-4, OIAS, OIASI
Replacement Item:
This antibody may replace item sc-100639 from Santa Cruz Biotechnology.
Description of Target:
OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.
Protein Size (# AA):
400
Molecular Weight:
46kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OAS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OAS1.
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-OAS1 (ARP30587_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
EXOC5; TRIM27; ACTN1; PRMT6; WBSCR22; RPL30; HCVgp1;
Blocking Peptide:
For anti-OAS1 (ARP30587_P050) antibody is Catalog # AAP30587
Datasheets / Downloads:
Printable datasheet for anti-OAS1 (ARP30587_P050) antibody
Sample Type Confirmation:

OAS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, MCF7

Publications:

Li, Q. & Tainsky, M. A. Higher miRNA tolerance in immortal Li-Fraumeni fibroblasts with abrogated interferon signaling pathway. Cancer Res. 71, 255-65 (2011). WB, IHC, Human 21199806

 
X
Ask a Question