NSMCE1 Antibody - middle region (ARP43406_P050)

Catalog No: ARP43406_P050

WB Suggested Anti-NSMCE1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NSMCE1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NSMCE1 (ARP43406_P050) antibody is Catalog # AAP43406 (Previous Catalog # AAPP11485)

Target Info

• Gene Symbol: NSMCE1
• Gene Full Name: Non-SMC element 1 homolog (S. cerevisiae)
• Alias Symbols: NSE1
• NCBI Gene Id: 197370
• Protein Name: Non-structural maintenance of chromosomes element 1 homolog
• Description of Target: NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.
• Uniprot ID: Q8WV22
• Protein Accession #: NP_659547
• Nucleotide Accession #: NM_145080
• Protein Size (# AA): 266
• Molecular Weight: 31kDa
• Protein Interactions: UBC; EID3; SMC6; NDNL2; Ube2k; UBE2D2; NSMCE2; NSMCE1; NSMCE4A; SMC5; SUMO2; MAGEF1;