NOSIP Antibody - middle region (ARP56785_P050)

Catalog No: ARP56785_P050

WB Suggested Anti-NOSIP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate

Rabbit Anti-NOSIP antibody
Catalog Number: ARP56785
Formalin Fixed Paraffin Embedded Tissue: Human Testis
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOSIP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NOSIP (ARP56785_P050) antibody is Catalog # AAP56785 (Previous Catalog # AAPP39641)

Target Info

• Gene Symbol: NOSIP
• Gene Full Name: Nitric oxide synthase interacting protein
• Alias Symbols: CGI-25
• NCBI Gene Id: 51070
• Protein Name: Nitric oxide synthase-interacting protein
• Description of Target: NOSIP negatively regulates nitric oxide production by inducing NOS1 and NOS3 translocation to actin cytoskeleton and inhibiting their enzymatic activity.
• Uniprot ID: Q9Y314
• Protein Accession #: NP_057037
• Nucleotide Accession #: NM_015953
• Protein Size (# AA): 301
• Molecular Weight: 33kDa
• Protein Interactions: UBC; WWOX; HECW2; DDX42; Nos1; NOS3; KPNA1; CUL3; SUMO2; EPOR;