Nfkbiz Antibody - C-terminal region (ARP57676_P050)

Catalog No: ARP57676_P050

WB Suggested Anti-Nfkbiz Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Brain

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 91%
• Peptide Sequence: Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Nfkbiz (ARP57676_P050) antibody is Catalog # AAP57676 (Previous Catalog # AAPP42107)

Target Info

• Gene Symbol: Nfkbiz
• Gene Full Name: Nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, zeta
• Alias Symbols: M, INAP, Mail, AA408868
• NCBI Gene Id: 80859
• Protein Name: NF-kappa-B inhibitor zeta
• Description of Target: Nfkbiz is involved in regulation of NF-kappa-B transcription factor complexes. It inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation. It inhibits DNA-binding of RELA and NFKB1/p50, and of the NF-kappa-B p65-p50 heterodimer and the NF-kappa-B p50-p50 homodimer. It seems also to activate NF-kappa-B-mediated transcription. In vitro, upon association with NFKB1/p50, Nfkbiz has transcriptional activation activity and, together with NFKB1/p50 and RELA, Nfkbiz is recruited to LCN2 promoters.
• Uniprot ID: Q9EST8
• Protein Accession #: NP_085115
• Nucleotide Accession #: NM_030612
• Protein Size (# AA): 728
• Molecular Weight: 80kDa
• Protein Interactions: Nfkb2; Nfkb1; Ikbkg; Elf5; Ehf; Il6;