Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP34504_T100
Price: $0.00
SKU
ARP34504_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NFKBIB (ARP34504_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human NFKBIB
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 91%; Dog: 83%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 77%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV
Concentration1.0 mg/ml
Blocking PeptideFor anti-NFKBIB (ARP34504_T100) antibody is Catalog # AAP34504 (Previous Catalog # AAPY00526)
Sample Type Confirmation

NFKBIB is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceJoo,M., (2005) J. Virol. 79 (12), 7648-7657
Gene SymbolNFKBIB
Gene Full NameNuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta
Alias SymbolsIKBB, TRIP9
NCBI Gene Id4793
Protein NameNF-kappa-B inhibitor beta
Description of TargetNFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM].NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM].
Uniprot IDQ15653
Protein Accession #NP_002494
Nucleotide Accession #NM_002503
Protein Size (# AA)356
Molecular Weight38kDa
Protein InteractionsVPS52; UBC; BAG3; TSPAN1; GIT2; RELA; REL; CSNK2A1; CDC25A; BAK1; APP; ZBTB7A; DNAJA3; IKBKB; CHUK; BRAP; IKBKG; TRE17; NFKBIA; NCOR2; PPARG; ESR2; POLR1D; POLR1E; POLR1A; POLR1C; POLR2H; NKIRAS2; POLR1B; NKIRAS1; LRPPRC; RASAL2; MTIF2; BTRC; CUL1; SKP1;
  1. What is the species homology for "NFKBIB Antibody - C-terminal region (ARP34504_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "NFKBIB Antibody - C-terminal region (ARP34504_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NFKBIB Antibody - C-terminal region (ARP34504_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NFKBIB Antibody - C-terminal region (ARP34504_T100)"?

    This target may also be called "IKBB, TRIP9" in publications.

  5. What is the shipping cost for "NFKBIB Antibody - C-terminal region (ARP34504_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NFKBIB Antibody - C-terminal region (ARP34504_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NFKBIB Antibody - C-terminal region (ARP34504_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NFKBIB Antibody - C-terminal region (ARP34504_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NFKBIB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NFKBIB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NFKBIB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NFKBIB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NFKBIB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NFKBIB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NFKBIB Antibody - C-terminal region (ARP34504_T100)
Your Rating
We found other products you might like!