NEURL2 Antibody - N-terminal region (ARP52524_P050)

Catalog No: ARP52524_P050

WB Suggested Anti-NEURL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NEURL2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NEURL2 (ARP52524_P050) antibody is Catalog # AAP52524 (Previous Catalog # AAPP30437)
• Reference: Song,R., (2006) J. Biol. Chem. 281 (47), 36391-36400

Target Info

• Gene Symbol: NEURL2
• Gene Full Name: Neuralized homolog 2 (Drosophila)
• Alias Symbols: OZZ, OZZ-E3, C20orf163
• NCBI Gene Id: 140825
• Protein Name: Neuralized-like protein 2
• Description of Target: NEURL2 contains 1 NHR (neuralized homology repeat) domain and 1 SOCS box domain. NEURL2 plays an important role in the process of myofiber differentiation and maturation. NEURL2 is the probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex, which mediates the ubiquitination of proteins. NEURL2 probably contributes to catalysis through recognition and positioning of the substrate and the ubiquitin-conjugating enzyme. During myogenesis, it controls the ubiquitination and degradation of the specific pool of CTNNB1/beta-catenin located at the sarcolemma.
• Uniprot ID: Q9BR09
• Protein Accession #: NP_542787
• Nucleotide Accession #: NM_080749
• Protein Size (# AA): 285
• Molecular Weight: 32kDa
• Protein Interactions: CTNNB1;