HSF2 antibody - N-terminal region (ARP31097_P050)

Catalog#: ARP31097_P050

• Size: 50ug

Human 721_B

• Description of Target: HSF2, as well as the related gene HSF1, binds specifically to the heat-shock element and has homology to HSFs of other species. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Although the names HSF1 and HSF2 were chosen for historical reasons, these peptides should be referred to as heat-shock transcription factors.
• Gene Symbol: HSF2
• Official Gene Full Name: Heat shock transcription factor 2
• Alias Symbols: MGC117376; MGC156196; MGC75048; HSF 2; HSTF 2
• Protein Accession#: NP_001129036
• Nucleotide Accession#: NM_001135564
• Swissprot Id: Q03933-2
• Host: Rabbit
• Protein Size (# AA): 518
• Molecular Weight: 58kDa
• Application: WB
• Partner Proteins: HSPA1A,NCAPG,HSF1,HSF2BP,NCAPG,NUP62,PPP2R1A,SUMO2,SUMO3,UBE2I,HSF1,NUP62,UBE2I
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: African clawed frog: 100%; Bovine: 100%; Guinea pig: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%; Mouse: 92%; Chicken: 85%
• Peptide Sequence: Synthetic peptide located within the following region: ILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFK
• Blocking Peptide: For anti-HSF2 antibody is Catalog # AAP31097 (Previous Catalog # AAPP01836)
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-HSF2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.