FBXO5 Antibody - C-terminal region (ARP43125_P050)

Catalog No: ARP43125_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-FBXO5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Host: Rabbit
Target Name: FBXO5
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: FBXO5
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: FBXO5
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FBXO5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 85%; Human: 100%; Pig: 79%; Rabbit: 92%
• Peptide Sequence: Synthetic peptide located within the following region: ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FBXO5 (ARP43125_P050) antibody is Catalog # AAP43125 (Previous Catalog # AAPP25094)
• Reference: Estrabaud,E., PLoS Pathog. 3 (7), E104 (2007)

Target Info

• Gene Symbol: FBXO5
• Gene Full Name: F-box protein 5
• Alias Symbols: EMI1, FBX5, Fbxo31
• NCBI Gene Id: 26271
• Protein Name: F-box only protein 5
• Description of Target: FBXO5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbxs class and is similar to xenopus early mitotic inhibitor-1 (Emi1), which is a mitotic regulator that interacts with Cdc20 and inhibits the anaphase promoting complex. Alternatively spliced transcript variants encoding different isoforms have been identified.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. This protein is similar to xenopus early mitotic inhibitor-1 (Emi1), which is a mitotic regulator that interacts with Cdc20 and inhibits the anaphase promoting complex. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9UKT4
• Protein Accession #: NP_036309
• Nucleotide Accession #: NM_012177
• Protein Size (# AA): 447
• Molecular Weight: 50kDa
• Protein Interactions: FBXW11; UBE2S; SKP1; UBC; TPM3; NEDD8; BRCA1; BARD1; ANAPC1; ANAPC11; ANAPC7; ANAPC5; FZR1; ANAPC4; ANAPC2; CDC16; CDC23; CDC27; CDC20; CDK1; MYC; Gm9174; BTRC; PLK1; EVI5;