FBXO46 Antibody - C-terminal region (ARP70416_P050)

Catalog No: ARP70416_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: FBXO46
Sample Type: HepG2 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FBXO46
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQNRG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FBXO46 (ARP70416_P050) antibody is Catalog # AAP70416

Target Info

• Gene Symbol: FBXO46
• Alias Symbols: Fbx46, FBXO34L, 20D7-FC4
• NCBI Gene Id: 23403
• Protein Name: F-box only protein 46
• Description of Target: Members of the F-box protein family, such as FBXO46, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
• Uniprot ID: Q6PJ61
• Protein Accession #: NP_001073938
• Nucleotide Accession #: NM_001080469
• Protein Size (# AA): 603
• Molecular Weight: 64kDa
• Protein Interactions: CUL1; HNRNPR; RUVBL1; SLC25A11; TCP1; SKP1; MCM4; DHX9; DDX5; NEDD8; COPS5;