FBXO24 antibody - middle region (ARP43377_P050)

Catalog#: ARP43377_P050

• Size: 50ug

Transfected 293T

• Description of Target: FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbxs class. Alternative splicing of this gene generates two transcript variants. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates two transcript variants.
• Gene Symbol: FBXO24
• Official Gene Full Name: F-box protein 24
• Alias Symbols: DKFZp434I1122; FBX24
• Protein Accession#: NP_277041
• Nucleotide Accession#: NM_033506
• Swissprot Id: O75426
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 580
• Molecular Weight: 65kDa
• Application: WB
• Immunogen: The immunogen for anti-FBXO24 antibody: synthetic peptide directed towards the middle region of human FBXO24
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LCATRECLYILSSHDIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMA
• Blocking Peptide: For anti-FBXO24 antibody is Catalog # AAP43377 (Previous Catalog # AAPP11456)
• Key Reference: Winston,J.T., (1999) Curr. Biol. 9 (20), 1180-1182
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-FBXO24 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: FBXO24 antibody tested with Human Transfected 293T Cells (ARP43377_P050)

Aviva Systems Biology is the original manufacturer of this FBXO24 antibody (ARP43377_P050)

Click here to view the FBXO24 antibody Western Blot Protocol

Product Datasheet Link: FBXO24 antibody (ARP43377_P050)

WB Suggested Anti-FBXO24 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Western Blot image:


Description of Target: FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbxs class. Alternative splicing of this gene generates two transcript variants. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates two transcript variants.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s FBXO24 antibody (ARP43377_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com