website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

FBXO24 antibody - middle region (ARP43377_P050)

Description of Target:
FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbxs class. Alternative splicing of this gene generates two transcript variants. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates two transcript variants.
Gene Symbol:
FBXO24
Official Gene Full Name:
F-box protein 24
NCBI Gene Id:
26261
Alias Symbols:
DKFZp434I1122; FBX24
Tissue Tool:
Find tissues and cell lines supported to express FBXO24.
Protein Accession #:
NP_277041
Nucleotide Accession#:
NM_033506
Swissprot Id:
O75426
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
F-box only protein 24
Protein Size (# AA):
580
Molecular Weight:
65kDa
Application:
WB
Immunogen:
The immunogen for anti-FBXO24 antibody: synthetic peptide directed towards the middle region of human FBXO24
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
FBXO24 antibody - middle region (ARP43377_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for
anti-FBXO24 antibody
- ARP43377_P050
Peptide Sequence:
Synthetic peptide located within the following region: LCATRECLYILSSHDIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMA
Blocking Peptide:
For anti-FBXO24 antibody is Catalog # AAP43377 (Previous Catalog # AAPP11456)
Key Reference:
Winston,J.T., (1999) Curr. Biol. 9 (20), 1180-1182
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-FBXO24 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question