website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - Monday 9/1/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

FBXO24 antibody - middle region (ARP43377_P050)

Description of Target:
FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbxs class. Alternative splicing of this gene generates two transcript variants. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates two transcript variants.
Gene Symbol:
FBXO24
Official Gene Full Name:
F-box protein 24
NCBI Gene Id:
26261
Alias Symbols:
DKFZp434I1122; FBX24
Tissue Tool:
Find tissues and cell lines supported to express FBXO24.
Protein Accession #:
NP_277041
Nucleotide Accession#:
NM_033506
Swissprot Id:
O75426
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
F-box only protein 24
Protein Size (# AA):
580
Molecular Weight:
65kDa
Application:
WB
Immunogen:
The immunogen for anti-FBXO24 antibody: synthetic peptide directed towards the middle region of human FBXO24
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
FBXO24 antibody - middle region (ARP43377_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for
anti-FBXO24 antibody
- ARP43377_P050
Peptide Sequence:
Synthetic peptide located within the following region: LCATRECLYILSSHDIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMA
Blocking Peptide:
For anti-FBXO24 antibody is Catalog # AAP43377 (Previous Catalog # AAPP11456)
Target Reference:
Winston,J.T., (1999) Curr. Biol. 9 (20), 1180-1182
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-FBXO24 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for FBXO24 antibody (ARP43377)

Product page for FBXO24 antibody (ARP43377)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Crab-eating macaque FBX24 antibody; Macaca fascicularis FBX24 antibody Q4R327 85%
Human FBX24 antibody; Homo sapiens FBX24 antibody O75426 100%
Human FBXO24 antibody; Homo sapiens FBXO24 antibody B4DY42 100%
Human FBXO24 antibody; Homo sapiens FBXO24 antibody B4DX91 100%
Human FBXO24 antibody; Homo sapiens FBXO24 antibody A4D2D3 100%
Lowland gorilla FBXO24 antibody; Gorilla gorilla gorilla FBXO24 antibody G3SD34 85%
Lowland gorilla FBXO24 antibody; Gorilla gorilla gorilla FBXO24 antibody G3S587 85%

Product Protocols: FBXO24 antibody tested with Human Transfected 293T Cells (ARP43377_P050)

Aviva Systems Biology is the original manufacturer of this FBXO24 antibody (ARP43377_P050)

Click here to view the FBXO24 antibody Western Blot Protocol

Product Datasheet Link: FBXO24 antibody (ARP43377_P050)

WB Suggested Anti-FBXO24 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Western Blot image:


Description of Target: FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbxs class. Alternative splicing of this gene generates two transcript variants. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates two transcript variants.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s FBXO24 antibody (ARP43377_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question