website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

FAS antibody - middle region (ARP30627_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $289.00

Special Price: $145.00

In Stock

Conjugation Options

ARP30627_P050-FITC Conjugated

ARP30627_P050-HRP Conjugated

ARP30627_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Fas (TNF receptor superfamily, member 6)
Protein Name:
Tumor necrosis factor receptor superfamily member 6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-1023 from Santa Cruz Biotechnology.
Description of Target:
FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FAS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FAS.
The immunogen is a synthetic peptide directed towards the middle region of human FAS
Species Reactivity:
Human, Pig
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 80%
Complete computational species homology data:
Anti-FAS (ARP30627_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FAS (ARP30627_P050) antibody is Catalog # AAP30627 (Previous Catalog # AAPP01280)
Datasheets / Downloads:
Printable datasheet for anti-FAS (ARP30627_P050) antibody

Product Protocols: FAS antibody tested with Human Fetal Liver Tissue (ARP30627_P050)

Aviva Systems Biology is the original manufacturer of this FAS antibody (ARP30627_P050)

Click here to view the FAS antibody Western Blot Protocol

Product Datasheet Link: FAS antibody (ARP30627_P050)

WB Suggested Anti-FAS Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Liver

Western Blot image:

Description of Target: FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s FAS antibody (ARP30627_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...