website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

FAS antibody - middle region (ARP30627_P050)

Description of Target:
FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.
Gene Symbol:
FAS
Official Gene Full Name:
Fas (TNF receptor superfamily, member 6)
NCBI Gene Id:
355
Alias Symbols:
ALPS1A; APO-1; APT1; CD95; FAS1; FASTM; TNFRSF6
Tissue Tool:
Find tissues and cell lines supported to express FAS.
Protein Accession #:
NP_000034
Nucleotide Accession#:
NM_000043
Swissprot Id:
P25445
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Tumor necrosis factor receptor superfamily member 6
Protein Size (# AA):
335
Molecular Weight:
36kDa
Application:
WB
Partner Proteins:
CTNNB1, KAT5, RUVBL2, TP63, SUMO1, ANK3, APAF1, BTK, C14orf1, CALM1, CASP8, CASP8AP2, CD47, CRMP1, DAXX, EEF1A1, EGFR, EZR, FADD, FAF1, FAIM2, FAS, FASLG, FBF1, FEM1B, FYN, HIPK3, LCK, LRIF1, MET, PDCD6, PRKCA, PTPN13, PTPN6, RAP1A, RIPK1, SUMO1, TNFSF13, TRADD, UBA7, UBE2I, ARHGDIA, BID, BRE, C14orf1, CASP10, CASP8, CASP8AP2, CFLAR, CRMP1, DAXX, EEF1A1, EZR, FADD, FADD, FADD, FAF1, FAIM2, FAS, FASLG, FBF1, FYN, HIPK3, LCK, LRIF1, MAPK8, MSN, NOL3, NOL3, PDCD6, RHOA, RIPK1, SUMO1, TNF, TNFRSF10B, TNFRSF1A, TNFSF13, UBE2I
Immunogen:
The immunogen for anti-FAS antibody: synthetic peptide directed towards the middle region of human FAS
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
FAS antibody - middle region (ARP30627_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 80%
Species Reactivity:
Human, Pig
Datasheets / Downloads:
Printable datasheet for
anti-FAS antibody
- ARP30627_P050
Peptide Sequence:
Synthetic peptide located within the following region: KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
Blocking Peptide:
For anti-FAS antibody is Catalog # AAP30627 (Previous Catalog # AAPP01280)
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-FAS antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question