website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

FAS antibody - middle region (ARP30627_P050)

Description of Target:
FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.
Gene Symbol:
Official Gene Full Name:
Fas (TNF receptor superfamily, member 6)
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express FAS.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Tumor necrosis factor receptor superfamily member 6
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-FAS antibody: synthetic peptide directed towards the middle region of human FAS
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
FAS antibody - middle region (ARP30627_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 80%
Species Reactivity:
Human, Pig
Datasheets / Downloads:
Printable datasheet for
anti-FAS antibody
- ARP30627_P050
Peptide Sequence:
Synthetic peptide located within the following region: KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
Blocking Peptide:
For anti-FAS antibody is Catalog # AAP30627 (Previous Catalog # AAPP01280)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-FAS antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for FAS antibody (ARP30627)

Product page for FAS antibody (ARP30627)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Assam macaque fas antibody; Macaca assamensis fas antibody Q9GK36 80%
Crab-eating macaque TNR6 antibody; Macaca fascicularis TNR6 antibody Q9TSN4 93%
Human FAS antibody; Homo sapiens FAS antibody Q8IUB7 100%
Human FAS antibody; Homo sapiens FAS antibody Q8IUB6 100%
Human FAS antibody; Homo sapiens FAS antibody Q6ICT6 100%
Human FAS antibody; Homo sapiens FAS antibody Q59FU8 100%
Human FAS antibody; Homo sapiens FAS antibody F5GWX3 100%
Human TNR6 antibody; Homo sapiens TNR6 antibody P25445 100%
Human TNR6 antibody; Homo sapiens TNR6 antibody P25445-6 100%
Lowland gorilla FAS antibody; Gorilla gorilla gorilla FAS antibody G3SG63 93%
Lowland gorilla FAS antibody; Gorilla gorilla gorilla FAS antibody G3S9B2 93%
Lowland gorilla FAS antibody; Gorilla gorilla gorilla FAS antibody G3RWR3 93%
Northern white-cheeked gibbon LOC100580318 antibody; Nomascus leucogenys LOC100580318 antibody G1RNU4 93%
Pig-tailed macaque TNR6 antibody; Macaca nemestrina TNR6 antibody Q9BDN0 80%
Rhesus macaque Mmu.649 antibody; Macaca mulatta Mmu.649 antibody F6V2J3 80%
Rhesus macaque Mmu.649 antibody; Macaca mulatta Mmu.649 antibody F6V1W6 80%
Rhesus macaque TNR6 antibody; Macaca mulatta TNR6 antibody Q9BDP2 80%
Sooty mangabey TNR6 antibody; Cercocebus atys TNR6 antibody Q9BDN4 80%
Stump-tailed macaque fas antibody; Macaca arctoides fas antibody Q9GK28 86%

Product Protocols: FAS antibody tested with Human Fetal Liver Tissue (ARP30627_P050)

Aviva Systems Biology is the original manufacturer of this FAS antibody (ARP30627_P050)

Click here to view the FAS antibody Western Blot Protocol

Product Datasheet Link: FAS antibody (ARP30627_P050)

WB Suggested Anti-FAS Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Liver

Western Blot image:

Description of Target: FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s FAS antibody (ARP30627_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question