website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

FAS antibody - middle region (ARP30627_P050)

Description of Target:
FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.
Gene Symbol:
Official Gene Full Name:
Fas (TNF receptor superfamily, member 6)
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express FAS.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Tumor necrosis factor receptor superfamily member 6
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-FAS antibody: synthetic peptide directed towards the middle region of human FAS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
FAS antibody - middle region (ARP30627_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 80%
Species Reactivity:
Human, Pig
Datasheets / Downloads:
Printable datasheet for
anti-FAS antibody
- ARP30627_P050
Peptide Sequence:
Synthetic peptide located within the following region: KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
Blocking Peptide:
For anti-FAS antibody is Catalog # AAP30627 (Previous Catalog # AAPP01280)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: FAS antibody tested with Human Fetal Liver Tissue (ARP30627_P050)

Aviva Systems Biology is the original manufacturer of this FAS antibody (ARP30627_P050)

Click here to view the FAS antibody Western Blot Protocol

Product Datasheet Link: FAS antibody (ARP30627_P050)

WB Suggested Anti-FAS Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Liver

Western Blot image:

Description of Target: FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s FAS antibody (ARP30627_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question