BRDT Antibody - N-terminal region (ARP38071_P050)

Catalog No: ARP38071_P050

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Rabbit Anti-BRDT antibody
Catalog Number: ARP38071
Formalin Fixed Paraffin Embedded Tissue: Human Testis
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BRDT
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MSLPSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSW
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BRDT (ARP38071_P050) antibody is Catalog # AAP38071 (Previous Catalog # AAPP20245)

Target Info

• Gene Symbol: BRDT
• Gene Full Name: Bromodomain, testis-specific
• Alias Symbols: CT9, BRD6, SPGF21
• NCBI Gene Id: 676
• Protein Name: Bromodomain testis-specific protein
• Description of Target: BRDT is similar to the RING3 protein family. It possesses 2 bromodomain motifs and a PEST sequence (a cluster of proline, glutamic acid, serine, and threonine residues), characteristic of proteins that undergo rapid intracellular degradation. The bromodomain is found in proteins that regulate transcription. Two transcript variants encoding the same protein have been found for this gene.
• Uniprot ID: Q58F21
• Protein Accession #: NP_001717
• Nucleotide Accession #: NM_001726
• Protein Size (# AA): 947
• Molecular Weight: 108kDa
• Protein Interactions: CDK9; CCNT1; UBC; VAV2; HIST2H4A;