OAS1 antibody - C-terminal region (ARP30587_P050)

Catalog#: ARP30587_P050

• Size: 50ug

Human HepG2

Human Small intestine

• Description of Target: OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.
• Gene Symbol: OAS1
• Official Gene Full Name: 2'-5'-oligoadenylate synthetase 1, 40/46kDa
• Alias Symbols: IFI-4; OIAS; OIASI
• Protein Accession#: NP_058132
• Nucleotide Accession#: NM_016816
• Swissprot Id: P00973
• Host: Rabbit
• Protein Size (# AA): 400
• Molecular Weight: 46kDa
• Application: WB, IHC
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
• Blocking Peptide: For anti-OAS1 antibody is Catalog # AAP30587
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-OAS1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.