- Description of Target:
- The protein encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity.
- Gene Symbol:
- GATA5
- Official Gene Full Name:
- GATA binding protein 5
- Alias Symbols:
- bB379O24.1
- Tissue Tool:
- Find tissues and cell lines supported to express GATA5.
- Protein Accession# :
- NP_536721
- Nucleotide Accession#:
- NM_080473
- Swissprot Id:
- Q9BWX5
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 397
- Molecular Weight:
- 41kDa
- Application:
- WB
- Partner Proteins:
- EP300, HNF1A, KLF2
- Immunogen:
- The immunogen for anti-GATA5 antibody: synthetic peptide directed towards the middle region of human GATA5
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- GATA5 antibody - middle region (ARP31627_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Bovine: 84%; Dog: 84%; Guinea pig: 84%; Horse: 84%; Pig: 84%; Sheep: 84%; Mouse: 76%; Rat: 76%
- Datasheets / Downloads:
- Printable datasheet for
anti-GATA5 antibody
- ARP31627_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: SAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHLEFKFEPEDFAFP
- Blocking Peptide:
- For anti-GATA5 antibody is Catalog # AAP31627 (Previous Catalog # AAPP02414)
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-GATA5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: GATA5 antibody tested with Human Ht1080 Cells (ARP31627_P050)
Aviva Systems Biology is the original manufacturer of this GATA5 antibody (ARP31627_P050)
Click here to view the GATA5 antibody Western Blot Protocol
Product Datasheet Link: GATA5 antibody (ARP31627_P050)
WB Suggested Anti-GATA5 Antibody Titration: 0.2-1 ug/ml
Positive Control: HT1080
Western Blot image: 
Description of Target: The protein encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s GATA5 antibody (ARP31627_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Review: GATA5 antibody-middle region (ARP31627_P050) in H460 lung cancer cell line using Western blot
Product Page for GATA5 antibody-middle region (ARP31627_P050)
Application: Western blotting
Species+tissue/cell type: H460 cell lysate
How many ug’s of tissue/cell lysate run on the gel:
1: 25 ug empty vector transfected H460 cell lysate
2: 25 ug hGATA5 transfected H460 cell lysate
Primary antibody dilution: 1:1200
Secondary antibody: Anti-rabbit HRP
Secondary antibody dilution: 1:3500
Questionnaire:
How do Aviva’s reagents play a role in your experimental goals?
The Aviva antibodies were used to detect protein levels in different cell lines.
How would you rate this antibody on a scale from 1-5 (5=best) and why?
4. Even though the antibody detects GATA5 signal, a very significant nonspecific signal is detected as well (only a few daltons above the GATA5 signal).
Would you use this antibody in future experiments?
Yes
Have you used another antibody which has worked in your application?
No
Do you believe the information about the reagent on Aviva’s website is correct?
To some extent.
If the antibody works, do you plan to use it in future experiments or to publish your data?
Yes. The antibody recognizes GATA5 protein.
How did you store the antibody after re-suspension?
Aliquots were stored at -80C for long term use and at -20C for short term use
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):
1: 25 ug empty vector transfected H460 cell lysate
2: 25 ug hGATA5 transfected H460 cell lysate
How many different experimental trials were conducted using the antibody sample?
3-4
How was this sample prepared?
The sample was prepared using the reagent and protocol from "MPER lysis" from Pierce company.
Primary antibody dilution and incubation time:
1:1200, overnight.
Secondary antibody used and dilution and incubation time:
Cell Signaling anti rabbit antibody, 1:3500.
What controls were used in your experiment (positive/negative)?
Overexpression cDNA vector versus empty vector in H460 lung cancer cell lines, which usually do not express GATA5.
Please include your detailed WB Procedure/Protocol here:
The protocol is from Pierce (MPER lysis), and is accessible online.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
