Zap70 Antibody - middle region (ARP61185_P050)

Catalog No: ARP61185_P050

WB Suggested Anti-Zap70 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRENLLVADIELGCGNFGS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Zap70 (ARP61185_P050) antibody is Catalog # AAP61185

Target Info

• Gene Symbol: Zap70
• Gene Full Name: Zeta-chain (TCR) associated protein kinase
• Alias Symbols: S, Srk, mur, ZAP-, mrtle, ZAP-70
• NCBI Gene Id: 22637
• Protein Name: Tyrosine-protein kinase ZAP-70
• Description of Target: Zap70 is a tyrosine kinase that plays an essential role in regulation of the adaptive immune response. Zap70 regulates motility, adhesion and cytokine expression of mature T cells, as well as thymocyte development. Zap70 contributes also to the development and activation of primary B lymphocytes.
• Uniprot ID: P43404
• Protein Accession #: NP_033565
• Nucleotide Accession #: NM_009539
• Protein Size (# AA): 618
• Molecular Weight: 70kDa
• Protein Interactions: Sla2; Was; Sla; Lck; Dlg1; Cbl; Slc4a1; Crkl; Cd247; Mapk14;