Ywhag Antibody - N-terminal region (ARP30643_P050)

Catalog No: ARP30643_P050

WB Suggested Anti-Ywhag Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Brain

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Ywhag (ARP30643_P050) antibody is Catalog # AAP30643

Target Info

• Gene Symbol: Ywhag
• Gene Full Name: Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
• Alias Symbols: D7Bwg1348e, 14-3-3gamma
• NCBI Gene Id: 22628
• Protein Name: 14-3-3 protein gamma
• Description of Target: Ywhag is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Ywhag binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Ywhag binding generally results in the modulation of the activity of the binding partner.
• Uniprot ID: P61982
• Protein Accession #: NP_061359
• Nucleotide Accession #: NM_018871
• Protein Size (# AA): 247
• Molecular Weight: 28kDa
• Protein Interactions: Mapt; Kcnma1; Mdm4; Eed; CALM1; Fbxo32; Rara; Rpgrip1l; Ywhaz; Mark3; Mark2; Nedd4l; Htt; Lrrk2; Crk; Ywhae; Lmna; SNCA;