SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP67917_P050
Price: $0.00
SKU
ARP67917_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-YTHDF2 (ARP67917_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human YTHDF2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: QEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Concentration0.5 mg/ml
Blocking PeptideFor anti-YTHDF2 (ARP67917_P050) antibody is Catalog # AAP67917
Sample Type Confirmation

YTHDF2 is supported by BioGPS gene expression data to be expressed in Jurkat

Enhanced Validation
WBY
SPR
YCHAROS
Publications

A potentially abundant junctional RNA motif stabilized by m6A and Mg2. Nat Commun. 9, 2761 (2018). 30018356

Context-dependent functional compensation between Ythdf m6A reader proteins. Genes Dev. 34, 1373-1391 (2020) 32943573

Control of Early B Cell Development by the RNA N6-Methyladenosine Methylation. Cell Rep. 31, 107819 (2020). 32610122

EGFR/SRC/ERK-stabilized YTHDF2 promotes cholesterol dysregulation and invasive growth of glioblastoma. Nat Commun. 12, 177 (2021). 33420027

m6A enhances the phase separation potential of mRNA. Nature. 571, 424-428 (2019). 31292544

m6A mRNA methylation regulates AKT activity to promote the proliferation and tumorigenicity of endometrial cancer. Nat Cell Biol. 20, 1074-1083 (2018). 30154548

YTHDF2/3 Are Required for Somatic Reprogramming through Different RNA Deadenylation Pathways. Cell Rep. 32, 108120 (2020). 32905781

Description
Gene SymbolYTHDF2
Alias SymbolsDF2, CAHL, HGRG8, NY-REN-2
NCBI Gene Id51441
Protein NameYTH domain family protein 2
Description of TargetThis gene encodes a member of the YTH (YT521-B homology) superfamily containing YTH domain. The YTH domain is typical for the eukaryotes and is particularly abundant in plants. The YTH domain is usually located in the middle of the protein sequence and may function in binding to RNA. In addition to a YTH domain, this protein has a proline rich region which may be involved in signal transduction. An Alu-rich domain has been identified in one of the introns of this gene, which is thought to be associated with human longevity. In addition, reciprocal translocations between this gene and the Runx1 (AML1) gene on chromosme 21 has been observed in patients with acute myeloid leukemia. This gene was initially mapped to chromosome 14, which was later turned out to be a pseudogene.
Uniprot IDQ9Y5A9
Protein Accession #NP_057342
Nucleotide Accession #NM_016258
Protein Size (# AA)579
Molecular Weight62 kDa
Protein InteractionsUBC; RPA3; RPA2; RPA1; RNF2; BMI1; EIF3H; EIF3A; FBXO6; TARDBP; HIPK4; VCAM1; FN1; EPAS1; ESR1; APP; SMAD3; CAND1; CUL3; ELAVL1; POT1; MEPCE; HNRNPH1; HNRNPA1;
  1. What is the species homology for "YTHDF2 Antibody - C-terminal region (ARP67917_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Rabbit".

  2. How long will it take to receive "YTHDF2 Antibody - C-terminal region (ARP67917_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "YTHDF2 Antibody - C-terminal region (ARP67917_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "YTHDF2 Antibody - C-terminal region (ARP67917_P050)"?

    This target may also be called "DF2, CAHL, HGRG8, NY-REN-2" in publications.

  5. What is the shipping cost for "YTHDF2 Antibody - C-terminal region (ARP67917_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "YTHDF2 Antibody - C-terminal region (ARP67917_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "YTHDF2 Antibody - C-terminal region (ARP67917_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "62 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "YTHDF2 Antibody - C-terminal region (ARP67917_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "YTHDF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "YTHDF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "YTHDF2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "YTHDF2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "YTHDF2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "YTHDF2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:YTHDF2 Antibody - C-terminal region (ARP67917_P050)
Your Rating
We found other products you might like!