WBP11 Antibody - N-terminal region (ARP46241_P050)

Catalog No: ARP46241_P050

WB Suggested Anti-WBP11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Hela cell lysateWBP11 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

Lanes:
1. Human NT-2 cells (60ug) lysate 2. Mouse WT brain extract (80ug)
Primary Antibody Dilution:
2ug/ml
Secondary Antibody:
IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution:
1: 20,000
Gene Name:
WBP11
Submitted by:
Dr. Yuzhi Chen, University of Arkansas for Medical Science

Host: Rabbit
Target Name: WBP11
Sample Type: Jurkat
Antibody Dilution: 1.0ug/mlWBP11 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Rabbit Anti-WBP11 Antibody
Catalog Number: ARP46241_P050
Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Amount and Sample Type:
500 ug mouse brain homogenate
Amount of IP Antibody:
6 ug
Primary Antibody:
WBP11
Primary Antibody Dilution:
1:500
Secondary Antibody:
Goat anti-rabbit Alexa-Fluor 594
Secondary Antibody Dilution:
1:5000
Gene Name:
WBP11
Submitted by:
Dr. Yuzhi Chen, University of Arkansas for Medical Science

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, IP, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WBP11
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-WBP11 (ARP46241_P050) antibody is Catalog # AAP46241 (Previous Catalog # AAPP27073)
• Sample Type Confirmation:

  WBP11 is strongly supported by BioGPS gene expression data to be expressed in HeLa, Jurkat

• Other Applications Image 1 Data: IP Suggested Anti-WBP11 antibody
  Titration: 2 ug/ml
  Positive Control: Mouse brain homogenate
  
• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Target Info

• Gene Symbol: WBP11
• Gene Full Name: WW domain binding protein 11
• Alias Symbols: BUG13, FAP90, NPWBP, SIPP1, VCTRL, CFAP90, VCTERL, WBP-11, PPP1R165
• NCBI Gene Id: 51729
• Protein Name: WW domain-binding protein 11
• Description of Target: WBP11 is a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. WBP11has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.This gene encodes a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. This protein has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.
• Uniprot ID: Q9Y2W2
• Protein Accession #: NP_057396
• Nucleotide Accession #: NM_016312
• Protein Size (# AA): 641
• Molecular Weight: 70kDa
• Protein Interactions: TESC; TRAF4; GRB2; FYN; UBC; BMI1; APBB1; WBP4; HECW2; DDX17; RBM5; PPP1CA; DDX5; CTNNBL1; PPP1CC; UPF3B; ZC3H13; CPSF6; SNRPB2; PQBP1; CD2BP2; SF3A2; ITSN1; RTN4IP1; PPP1CB; GIGYF2; MCRS1; PRPF40A; C5orf22; NCK2; TRIP10; NCF1; VIM; SRC; PIK3R1; RUNX1T1;