TOX3 Antibody - N-terminal region (ARP45744_P050)

Catalog No: ARP45744_P050

Host: Rabbit
Target Name: TOX3
Sample Type: 293T Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TOX3
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: MKCQPRSGARRIEERLHYLITTYLKFGNNNNYMNMAEANNAFFAASETFH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TOX3 (ARP45744_P050) antibody is Catalog # AAP45744

Target Info

• Gene Symbol: TOX3
• Alias Symbols: CAGF9, TNRC9
• NCBI Gene Id: 27324
• Description of Target: The protein encoded by this gene contains an HMG-box, indicating that it may be involved in bending and unwinding of DNA and alteration of chromatin structure. The C-terminus of the encoded protein is glutamine-rich due to CAG repeats in the coding sequence. A minor allele of this gene has been implicated in an elevated risk of breast cancer. Two transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: O15405-2
• Protein Accession #: NP_001139660
• Protein Size (# AA): 571
• Molecular Weight: 62kDa
• Protein Interactions: Dlg4;