Thra Antibody - C-terminal region (ARP34779_P050)

Catalog No: ARP34779_P050

WB Suggested Anti-Thra Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Muscle

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: MSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Thra (ARP34779_P050) antibody is Catalog # AAP34779 (Previous Catalog # AAPP23669)

Target Info

• Gene Symbol: Thra
• Gene Full Name: Thyroid hormone receptor alpha
• Alias Symbols: ERBA1, Thra1, c-erbA-1
• NCBI Gene Id: 81812
• Protein Name: Thyroid hormone receptor alpha
• Description of Target: Thra binds the promoter of the Na+/H+ exchanger NHE1 and mediates thyroid hormone induced transcriptional activation.
• Uniprot ID: P63059
• Protein Accession #: NP_001017960
• Nucleotide Accession #: NM_001017960
• Protein Size (# AA): 492
• Molecular Weight: 55kDa
• Protein Interactions: Pik3r1;