Catalog No: ARP57920_P050
Price: $0.00
SKU
ARP57920_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TAF1C (ARP57920_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TAF1C
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 77%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGAL
Concentration0.5 mg/ml
Blocking PeptideFor anti-TAF1C (ARP57920_P050) antibody is Catalog # AAP57920 (Previous Catalog # AAPP32331)
Sample Type Confirmation

TAF1C is strongly supported by BioGPS gene expression data to be expressed in Jurkat

SubunitC
ReferenceFriedrich,J.K., (2005) J. Biol. Chem. 280 (33), 29551-29558
Gene SymbolTAF1C
Gene Full NameTATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa
Alias SymbolsSL1, TAFI95, TAFI110, MGC:39976
NCBI Gene Id9013
Protein NameTATA box-binding protein-associated factor RNA polymerase I subunit C
Description of TargetInitiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1C is the largest SL1-specific TAF. Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.
Uniprot IDQ15572
Protein Accession #NP_005670
Nucleotide Accession #NM_005679
Protein Size (# AA)869
Molecular Weight95kDa
Protein InteractionsUBC; Tbp; Taf1b; Taf1a; UFD1L; TTR; TK1; SMN1; H2AFX; TAF12; TAF1D; POLR1E; RRN3; TRIM24; TP53; UBTF; CD3EAP; MYC;
  1. What is the species homology for "TAF1C Antibody - N-terminal region (ARP57920_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Guinea Pig, Horse".

  2. How long will it take to receive "TAF1C Antibody - N-terminal region (ARP57920_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAF1C Antibody - N-terminal region (ARP57920_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAF1C Antibody - N-terminal region (ARP57920_P050)"?

    This target may also be called "SL1, TAFI95, TAFI110, MGC:39976" in publications.

  5. What is the shipping cost for "TAF1C Antibody - N-terminal region (ARP57920_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAF1C Antibody - N-terminal region (ARP57920_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAF1C Antibody - N-terminal region (ARP57920_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "95kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAF1C Antibody - N-terminal region (ARP57920_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TAF1C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAF1C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAF1C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAF1C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAF1C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAF1C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAF1C Antibody - N-terminal region (ARP57920_P050)
Your Rating
We found other products you might like!