- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-SIGLEC12 (ARP50183_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Rat, Cow, Horse, Pig, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SIGLEC12 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 77%; Horse: 83%; Human: 100%; Pig: 86%; Rat: 77%; Zebrafish: 82% |
Peptide Sequence | Synthetic peptide located within the following region: GRFLLLGDPQTNNCSLSIRDARKGDSGKYYFQVERGSRKWNYIYDKLSVH |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SIGLEC12 (ARP50183_P050) antibody is Catalog # AAP50183 (Previous Catalog # AAPP29636) |
Reference | Angata,T., (2001) J. Biol. Chem. 276 (43), 40282-40287 |
Gene Symbol | SIGLEC12 |
---|---|
Gene Full Name | Sialic acid binding Ig-like lectin 12 (gene/pseudogene) |
Alias Symbols | S2V, SLG, SIGLECL1, Siglec-XII |
NCBI Gene Id | 89858 |
Protein Name | Sialic acid-binding Ig-like lectin 12 |
Description of Target | Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. SIGLEC12 is a member of the SIGLEC3-like subfamily of SIGLECs. SIGLEC12, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor.Western blots using four different antibodies against four unique regions of this protein target confirm the same apparent molecular weight in our tests.Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor. This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. |
Uniprot ID | Q96PQ1 |
Protein Accession # | NP_443729 |
Nucleotide Accession # | NM_053003 |
Protein Size (# AA) | 595 |
Molecular Weight | 63kDa |
Protein Interactions | CMAS; PTPN6; PTPN11; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SIGLEC12 Antibody - N-terminal region (ARP50183_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Horse, Pig, Zebrafish".
-
How long will it take to receive "SIGLEC12 Antibody - N-terminal region (ARP50183_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "SIGLEC12 Antibody - N-terminal region (ARP50183_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SIGLEC12 Antibody - N-terminal region (ARP50183_P050)"?
This target may also be called "S2V, SLG, SIGLECL1, Siglec-XII" in publications.
-
What is the shipping cost for "SIGLEC12 Antibody - N-terminal region (ARP50183_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SIGLEC12 Antibody - N-terminal region (ARP50183_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SIGLEC12 Antibody - N-terminal region (ARP50183_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "63kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SIGLEC12 Antibody - N-terminal region (ARP50183_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SIGLEC12"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SIGLEC12"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SIGLEC12"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SIGLEC12"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SIGLEC12"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SIGLEC12"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.