SFRP2 Antibody - middle region (ARP56543_P050)

Catalog No: ARP56543_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-SFRP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

Host: Rabbit
Target Name: SFRP2
Sample Tissue: Human MCF7 Whole Cell
Antibody Dilution: 1ug/ml

Host: Rabbit
Target Name: SFRP2
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 3ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFRP2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SFRP2 (ARP56543_P050) antibody is Catalog # AAP56543 (Previous Catalog # AAPP35412)
• Reference: Elston,M.S., (2008) Endocrinology 149 (3), 1235-1242

Target Info

• Gene Symbol: SFRP2
• Gene Full Name: Secreted frizzled-related protein 2
• Alias Symbols: FRP-2, SARP1, SDF-5
• NCBI Gene Id: 6423
• Protein Name: Secreted frizzled-related protein 2
• Description of Target: SFRP2 is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q96HF1
• Protein Accession #: NP_003004
• Nucleotide Accession #: NM_003013
• Protein Size (# AA): 295
• Molecular Weight: 31kDa
• Protein Interactions: WNT4; PAX2; WNT1; FN1;