RPL23A Antibody - C-terminal region (ARP61966_P050)

Catalog No: ARP61966_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-RPL23A Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole CellThere is BioGPS gene expression data showing that RPL23A is expressed in Jurkat

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RPL23A (ARP61966_P050) antibody is Catalog # AAP61966 (Previous Catalog # AAPP48306)
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that RPL23A is expressed in Jurkat

Target Info

• Gene Symbol: RPL23A
• Gene Full Name: Ribosomal protein L23a
• Alias Symbols: L23A, MDA20
• NCBI Gene Id: 6147
• Protein Name: 60S ribosomal protein L23a
• Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L23P family of ribosomal proteins. It is located in the cytoplasm. The protein may be one of the target molecules involved in mediating growth inhibition by interferon. In yeast, the corresponding protein binds to a specific site on the 26S rRNA. This gene is co-transcribed with the U42A, U42B, U101A, and U101B small nucleolar RNA genes, which are located in its third, first, second, and fourth introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
• Uniprot ID: P62750
• Protein Accession #: NP_000975
• Nucleotide Accession #: NM_000984
• Protein Size (# AA): 156
• Molecular Weight: 18kDa
• Protein Interactions: CEP76; CEP250; TUBGCP3; TP53; UBC; RNF2; EED; EIF3CL; DIMT1; NMT1; RPS27; SND1; NELFB; RPL36; RPL35; IGF2BP3; SYNCRIP; EEF1E1; AIMP1; EIF3D; RPS11; RPLP0; RPL24; RPL21; RPL19; RPL18; RPL15; RPL13; MAP2; IARS; HNRNPU; EPRS; RPL7A; QARS; PPIA; PA2G4; YBX1;