RFX5 Antibody - C-terminal region (ARP37993_P050)

Catalog No: ARP37993_P050

WB Suggested Anti-RFX5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysateRFX5 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RFX5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: VIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RFX5 (ARP37993_P050) antibody is Catalog # AAP37993 (Previous Catalog # AAPP20095)
• Sample Type Confirmation:

  RFX5 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Xu,Y., (2007) J. Biol. Chem. 282 (36), 26046-26056

Target Info

• Gene Symbol: RFX5
• Gene Full Name: Regulatory factor X, 5 (influences HLA class II expression)
• Alias Symbols: -
• NCBI Gene Id: 5993
• Protein Name: DNA-binding protein RFX5
• Description of Target: RFX5 is the fifth member of the growing family of DNA-binding proteins sharing a novel and highly characteristic DNA-binding domain called the RFX motif. RFX is a nuclear protein complex that binds to the X box of MHC-II promoters. The lack of RFX binding activity in complementation group C results from mutations in the RFX5 gene encoding the 75-kD subunit of RFX.A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BLS. The molecular defects in complementation groups B, C, and D all lead to a deficiency in RFX.A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BLS. The molecular defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC-II promoters. The lack of RFX binding activity in complementation group C results from mutations in the RFX5 gene encoding the 75-kD subunit of RFX (Steimle et al., 1995). RFX5 is the fifth member of the growing family of DNA-binding proteins sharing a novel and highly characteristic DNA-binding domain called the RFX motif. Multiple alternatively spliced transcript variants have been found but the full-length natures of only two have been determined.A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BLS. The molecular defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC-II promoters. The lack of RFX binding activity in complementation group C results from mutations in the RFX5 gene encoding the 75-kD subunit of RFX (Steimle et al., 1995). RFX5 is the fifth member of the growing family of DNA-binding proteins sharing a novel and highly characteristic DNA-binding domain called the RFX motif. Multiple alternatively spliced transcript variants have been found but the full-length natures of only two have been determined.
• Uniprot ID: P48382
• Protein Accession #: NP_000440
• Nucleotide Accession #: NM_000449
• Protein Size (# AA): 616
• Molecular Weight: 65kDa
• Protein Interactions: UBC; MRPL53; SLIRP; SRPRB; CDV3; LSM7; RPS19; RBMS1; NDUFA7; NDUFA2; ANKRA2; RFXANK; MLLT1; HDAC4; CIITA; HDAC2; RFXAP;