Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP40626_T100
Price: $0.00
SKU
ARP40626_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PPIE (ARP40626_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Guinea Pig, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PPIE
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 100%; Human: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG
Concentration1.0 mg/ml
Blocking PeptideFor anti-PPIE (ARP40626_T100) antibody is Catalog # AAP40626 (Previous Catalog # AAPP22782)
Sample Type Confirmation

PPIE is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceFair,K., (2001) Mol. Cell. Biol. 21 (10), 3589-3597
Gene SymbolPPIE
Gene Full NamePeptidylprolyl isomerase E (cyclophilin E)
Alias SymbolsCYP33, CYP-33
NCBI Gene Id10450
Description of TargetPPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activityThe protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed.
Uniprot IDQ9UNP9
Protein Accession #NP_982282
Nucleotide Accession #NM_203457
Protein Size (# AA)235
Molecular Weight26kDa
Protein InteractionsXAB2; BMI1; UBC; EIF4A3; MAGOH; SF3A2; HHV8GK18_gp81; SUMO2; Prpf8; Cdc5l; Snw1; KMT2A; PHYHIP;
  1. What is the species homology for "PPIE Antibody - middle region (ARP40626_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Guinea Pig, Yeast, Zebrafish".

  2. How long will it take to receive "PPIE Antibody - middle region (ARP40626_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PPIE Antibody - middle region (ARP40626_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PPIE Antibody - middle region (ARP40626_T100)"?

    This target may also be called "CYP33, CYP-33" in publications.

  5. What is the shipping cost for "PPIE Antibody - middle region (ARP40626_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PPIE Antibody - middle region (ARP40626_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PPIE Antibody - middle region (ARP40626_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "26kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PPIE Antibody - middle region (ARP40626_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PPIE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PPIE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PPIE"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PPIE"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PPIE"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PPIE"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PPIE Antibody - middle region (ARP40626_T100)
Your Rating
We found other products you might like!