SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP70964_P050
Price: $0.00
SKU
ARP70964_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NSMCE4A (ARP70964_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human NSMCE4A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: NEENEGFEHNTQVRNQGIIALSYRDWEIVKTFEISEPVITPSQRQQKPSA
Concentration0.5 mg/ml
Blocking PeptideFor anti-NSMCE4A (ARP70964_P050) antibody is Catalog # AAP70964
Sample Type Confirmation

NSMCE4A is strongly supported by BioGPS gene expression data to be expressed in HepG2

Gene SymbolNSMCE4A
Alias SymbolsNS4EA, NSE4A, C10orf86
NCBI Gene Id54780
Description of TargetNSMCE4A is a component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). It is involved in positive regulation of response to DNA damage stimulus.
Uniprot IDQ9NXX6
Protein Accession #NP_001161337
Nucleotide Accession #NM_001167865
Protein Size (# AA)384
Molecular Weight42kDa
Protein InteractionsUBC; HECW2; SRPK2; SRPK1; MAGED4B; NDNL2; MAGEC2; MAGEH1; MAGED2; NDN; MAGEB1; MAGEA1; NSMCE1; SMC6;
  1. What is the species homology for "NSMCE4A Antibody - C-terminal region (ARP70964_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "NSMCE4A Antibody - C-terminal region (ARP70964_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NSMCE4A Antibody - C-terminal region (ARP70964_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NSMCE4A Antibody - C-terminal region (ARP70964_P050)"?

    This target may also be called "NS4EA, NSE4A, C10orf86" in publications.

  5. What is the shipping cost for "NSMCE4A Antibody - C-terminal region (ARP70964_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NSMCE4A Antibody - C-terminal region (ARP70964_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NSMCE4A Antibody - C-terminal region (ARP70964_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NSMCE4A Antibody - C-terminal region (ARP70964_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NSMCE4A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NSMCE4A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NSMCE4A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NSMCE4A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NSMCE4A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NSMCE4A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NSMCE4A Antibody - C-terminal region (ARP70964_P050)
Your Rating
We found other products you might like!