MGA Antibody - C-terminal region (ARP47556_P050)

Catalog No: ARP47556_P050

Host: Rabbit
Target Name: MGA
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 1.0ug/mlMGA is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MGA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 85%; Horse: 92%; Human: 100%; Mouse: 79%; Pig: 92%; Rabbit: 79%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: ASLQMKRESQNPDQKDETNSIKREQETKKVLQSEGEAVDPEANVIKQNSG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MGA (ARP47556_P050) antibody is Catalog # AAP47556
• Sample Type Confirmation:

  MGA is supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Gene Symbol: MGA
• Gene Full Name: MAX gene associated
• Alias Symbols: MAD5, MXD5
• NCBI Gene Id: 23269
• Protein Name: MAX gene-associated protein
• Description of Target: MGA functions as a dual-specificity transcription factor, regulating the expression of both MAX-network and T-box family target genes and functions as a repressor or an activator. It binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence and seems to regulate MYC-MAX target genes. It suppresses transcriptional activation by MYC and inhibits MYC-dependent cell transformation. It function activated by heterodimerization with MAX. This heterodimerization serves the dual function of both generating an E-box-binding heterodimer and simultaneously blocking interaction of a corepressor
• Uniprot ID: Q8IWI9-2
• Protein Size (# AA): 697
• Molecular Weight: 76kDa
• Protein Interactions: SUMO2; SUMO3; EED; RNF2; MAX; SMAD1; LSM8; UBC; CD2BP2; CBX2; PCGF6; RYBP; PCGF3; YAF2; CBX4; CBX3; E2F4; E2F3; E2F1;