LSM5 Antibody - middle region (ARP66856_P050)

Catalog No: ARP66856_P050

WB Suggested Anti-LSM5 Antibody
Titration: 1.0 ug/ml
Positive Control: MCF7 Whole CellLSM5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LSM5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP66856
• Sample Type Confirmation:

  LSM5 is strongly supported by BioGPS gene expression data to be expressed in MCF7

Target Info

• Gene Symbol: LSM5
• Alias Symbols: YER146W
• NCBI Gene Id: 23658
• Protein Name: U6 snRNA-associated Sm-like protein LSm5
• Description of Target: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
• Uniprot ID: Q9Y4Y9
• Protein Accession #: NP_036454
• Nucleotide Accession #: NM_012322
• Protein Size (# AA): 91
• Molecular Weight: 10kDa
• Protein Interactions: LSM7; LSM6; SNRPF; UBC; LSM3; BAG3; DHX16; UBE3A; SPTB; PPP1R10; GTF2B; RMI2; LSM2; MIF4GD; LSM4; EXOSC5; LSM8; LSM1; HNRNPD; SMN2; SNRPE;