KIN Antibody - middle region (ARP32295_T100)

Catalog No: ARP32295_T100

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-KIN Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIN
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EEKTAKFIEEQVRRGLEGKEQEVPTFTELSRENDEEKVTFNLSKGACSSS
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-KIN (ARP32295_T100) antibody is Catalog # AAP32295 (Previous Catalog # AAPP23961)
• Reference: le Acta Crystallograph. Sect. F Struct. Biol. Cryst. Commun. 62 (PT

Target Info

• Gene Symbol: KIN
• Gene Full Name: KIN, antigenic determinant of recA protein homolog (mouse)
• Alias Symbols: BTCD, Rts2, KIN17
• NCBI Gene Id: 22944
• Protein Name: DNA/RNA-binding protein KIN17
• Description of Target: Kin is a nuclear protein that forms intranuclear foci during proliferation and is redistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization of the protein, suggesting its participation in the cellular response to DNA damage. Originally selected based on protein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of the bacterial RecA protein, a characteristic shared by the human ortholog.The protein encoded by this gene is a nuclear protein that forms intranuclear foci during proliferation and is redistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization of the protein, suggesting its participation in the cellular response to DNA damage. Originally selected based on protein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of the bacterial RecA protein, a characteristic shared by this human ortholog.
• Uniprot ID: O60870
• Protein Accession #: NP_036443
• Nucleotide Accession #: NM_012311
• Protein Size (# AA): 393
• Molecular Weight: 45kDa
• Protein Interactions: UBC; HECW2; RPA1; PCNA; METTL22; Bud13; RPA2;