IPMK Antibody - middle region (ARP65580_P050)

Catalog No: ARP65580_P050

Host: Rabbit
Target Name: IPMK
Sample Type: Hela Whole cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human IPMK
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 93%; Yeast: 85%; Zebrafish: 77%
• Peptide Sequence: Synthetic peptide located within the following region: SDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKIL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IPMK (ARP65580_P050) antibody is Catalog # AAP65580

Target Info

• Gene Symbol: IPMK
• Gene Full Name: inositol polyphosphate multikinase
• Alias Symbols: -
• NCBI Gene Id: 253430
• Protein Name: Inositol polyphosphate multikinase
• Description of Target: This gene encodes a member of the inositol phosphokinase family. The encoded protein has 3-kinase, 5-kinase and 6-kinase activities on phosphorylated inositol substrates. The encoded protein plays an important role in the biosynthesis of inositol 1,3,4,5,6-pentakisphosphate, and has a preferred 5-kinase activity. This gene may play a role in nuclear mRNA export. Pseudogenes of this gene are located on the long arm of chromosome 13 and the short arm of chromosome 19.
• Uniprot ID: Q8NFU5
• Protein Accession #: NP_689416
• Nucleotide Accession #: NM_152230
• Protein Size (# AA): 416
• Molecular Weight: 45kDa
• Protein Interactions: UBC;