Hsd17b11 Antibody - middle region (ARP40842_P050)

Catalog No: ARP40842_P050

WB Suggested Anti-Hsd17b11 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: IYSAAKKVKEEVGDVSILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Hsd17b11 (ARP40842_P050) antibody is Catalog # AAP40842

Target Info

• Gene Symbol: Hsd17b11
• Gene Full Name: Hydroxysteroid (17-beta) dehydrogenase 11
• Alias Symbols: Pa, Dhr, SDR2, retS, Dhrs8, Pan1b, retSDR2
• NCBI Gene Id: 114664
• Protein Name: Estradiol 17-beta-dehydrogenase 11
• Description of Target: Hsd17b11 can convert androstan-3-alpha,17-beta-diol (3-alpha-diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. Hsd17b11 may act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. It has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione.
• Uniprot ID: Q9EQ06
• Protein Accession #: NP_444492
• Nucleotide Accession #: NM_053262
• Protein Size (# AA): 298
• Molecular Weight: 33kDa
• Protein Interactions: Eed;