SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP60985_P050
Price: $0.00
SKU
ARP60985_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Hist2h4 Antibody - middle region (ARP60985_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for ARP60985_P050
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityMouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: LARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDV
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAP60985
Gene SymbolHist2h4
Gene Full NameHistone cluster 2, H4
Alias SymbolsH4, H4c1, H4c2, H4c3, H4c4, H4c6, H4c8, H4c9, H4c11, H4c12, H4f16, Hist2, X04652, Hist2h4
NCBI Gene Id97122
Protein NameHistone H4
Description of TargetHist2h4 is a core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Uniprot IDP62806
Protein Accession #NP_291074
Nucleotide Accession #NM_033596
Protein Size (# AA)103
Molecular Weight11kDa
Protein InteractionsCsrp2bp; Wdtc1; Myocd; Zbtb16; Tcf3;
  1. What is the species homology for "Hist2h4 Antibody - middle region (ARP60985_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "Hist2h4 Antibody - middle region (ARP60985_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Hist2h4 Antibody - middle region (ARP60985_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Hist2h4 Antibody - middle region (ARP60985_P050)"?

    This target may also be called "H4, H4c1, H4c2, H4c3, H4c4, H4c6, H4c8, H4c9, H4c11, H4c12, H4f16, Hist2, X04652, Hist2h4" in publications.

  5. What is the shipping cost for "Hist2h4 Antibody - middle region (ARP60985_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Hist2h4 Antibody - middle region (ARP60985_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Hist2h4 Antibody - middle region (ARP60985_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "11kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Hist2h4 Antibody - middle region (ARP60985_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HIST2H4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HIST2H4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HIST2H4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HIST2H4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HIST2H4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HIST2H4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Hist2h4 Antibody - middle region (ARP60985_P050)
Your Rating