H13 Antibody - middle region (ARP49964_P050)

Catalog No: ARP49964_P050

WB Suggested Anti-H13 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Spleen

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: IKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-H13 (ARP49964_P050) antibody is Catalog # AAP49964 (Previous Catalog # AAPP44254)

Target Info

• Gene Symbol: H13
• Gene Full Name: Histocompatibility 13
• Alias Symbols: Spp, H-13, Hm13, PSL3, AV020344, 1200006O09Rik, 4930443L17Rik, 5031424B04Rik
• NCBI Gene Id: 14950
• Protein Name: Minor histocompatibility antigen H13
• Description of Target: H13 catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. It is required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides. Involved in the intramembrane cleavage of the integral membrane protein PSEN1 By similarity. It may play a role in graft rejection.
• Uniprot ID: Q9D8V0
• Protein Accession #: NP_034506
• Nucleotide Accession #: NM_010376
• Protein Size (# AA): 378
• Molecular Weight: 42kDa