DCAF17 Antibody - N-terminal region (ARP70122_P050)

Catalog No: ARP70122_P050

Host: Rabbit
Target Name: DCAF17
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 1.0ug/mlDCAF17 is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCAF17
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FDNYRRCVSSVASEPRKLYEMPKCSKSEKIEDALLWECPVGDILPNSSDY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DCAF17 (ARP70122_P050) antibody is Catalog # AAP70122
• Sample Type Confirmation:

  DCAF17 is supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Gene Symbol: DCAF17
• Alias Symbols: C2orf37, C20orf37
• NCBI Gene Id: 80067
• Protein Name: DDB1- and CUL4-associated factor 17 Ensembl ENSP00000442238
• Description of Target: This gene encodes a nuclear transmembrane protein that associates with cullin 4A/damaged DNA binding protein 1 ubiquitin ligase complex. Mutations in this gene are associated with Woodhouse-Sakati syndrome. Alternate splicing results in multiple transcript variants.
• Uniprot ID: F5H7W1
• Protein Accession #: NP_001158293
• Nucleotide Accession #: NM_001164821
• Protein Size (# AA): 453
• Molecular Weight: 51kDa
• Protein Interactions: CUL4A; CUL4B; DDB1; DDA1; COPS6; UBC;