Cdk14 Antibody - C-terminal region (ARP61958_P050)

Catalog No: ARP61958_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-Cdk14 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Pancreas

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Cdk14 (ARP61958_P050) antibody is Catalog # AAP61958

Target Info

• Gene Symbol: Cdk14
• Gene Full Name: Cyclin-dependent kinase 14
• Alias Symbols: Pftk, Pftk1, mKIAA0834
• NCBI Gene Id: 18647
• Protein Name: Cyclin-dependent kinase 14
• Description of Target: Cdk14 is a Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin. Cdk14 acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by mediating the phosphorylation of LRP6 at 'Ser-1490', leading to the activation of the Wnt signaling pathway. Cdk14 acts as a regulator of cell cycle progression and cell proliferation via its interaction with CCDN3. Phosphorylates RB1 in vitro, however the relevance of such result remains to be confirmed in vivo. Cdk14 may also play a role in meiosis, neuron differentiation and may indirectly act as a negative regulator of insulin-responsive glucose transport.
• Uniprot ID: O35495
• Protein Accession #: NP_035204
• Nucleotide Accession #: NM_011074
• Protein Size (# AA): 469
• Molecular Weight: 53kDa
• Protein Interactions: SMURF1; TGFBR1; BMPR1B; ACVR1;