Catalog No: ARP63006_P050
Price: $0.00
SKU
ARP63006_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CD86 (ARP63006_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Pig: 100%
Peptide SequenceSynthetic peptide located within the following region: DVTSNMTIFCILETDKTRLLSSPFSIGTNTMEREESEQTKKREKIHIPER
Concentration0.5 mg/ml
Blocking PeptideFor anti-CD86 (ARP63006_P050) antibody is Catalog # AAP63006
Gene SymbolCD86
Gene Full NameCD86 molecule
Alias SymbolsB70, B7-2, B7.2, LAB72, CD28LG2
NCBI Gene Id942
Protein NameT-lymphocyte activation antigen CD86
Description of TargetThis gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.
Uniprot IDP42081-4
Protein Accession #NP_795711
Nucleotide Accession #NM_176892
Protein Size (# AA)275
Molecular Weight30kDa
Protein InteractionsUBC; CTLA4; ECE2; PARP1; MARCH1; MARCH8; CD86; CD28; CD80;
  1. What is the species homology for "CD86 Antibody - C-terminal region (ARP63006_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Pig".

  2. How long will it take to receive "CD86 Antibody - C-terminal region (ARP63006_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CD86 Antibody - C-terminal region (ARP63006_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CD86 Antibody - C-terminal region (ARP63006_P050)"?

    This target may also be called "B70, B7-2, B7.2, LAB72, CD28LG2" in publications.

  5. What is the shipping cost for "CD86 Antibody - C-terminal region (ARP63006_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CD86 Antibody - C-terminal region (ARP63006_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CD86 Antibody - C-terminal region (ARP63006_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "30kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CD86 Antibody - C-terminal region (ARP63006_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CD86"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CD86"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CD86"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CD86"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CD86"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CD86"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CD86 Antibody - C-terminal region (ARP63006_P050)
Your Rating
We found other products you might like!