BOLL Antibody - N-terminal region (ARP41065_P050)

Catalog No: ARP41065_P050

WB Suggested Anti-BOLL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BOLL
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BOLL (ARP41065_P050) antibody is Catalog # AAP41065 (Previous Catalog # AAPS01910)
• Reference: Kostova,E., (2007) Mol. Hum. Reprod. 13 (2), 85-93

Target Info

• Gene Symbol: BOLL
• Gene Full Name: Bol, boule-like (Drosophila)
• Alias Symbols: BOULE
• NCBI Gene Id: 66037
• Protein Name: Protein boule-like
• Description of Target: This gene belongs to the DAZ gene family required for germ cell development. BOLL is an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition. This gene belongs to the DAZ gene family required for germ cell development. It encodes an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Uniprot ID: Q8N9W6
• Protein Accession #: NP_149019
• Nucleotide Accession #: NM_033030
• Protein Size (# AA): 283
• Molecular Weight: 31kDa
• Protein Interactions: ZNF385C; HNRNPLL; C1orf94; RBFOX2; RBPMS; TFG; SERF2; NPBWR2; DAZ1; DAZ4;