BCL2L12 Antibody - middle region (ARP61767_P050)

Catalog No: ARP61767_P050

WB Suggested Anti-BCL2L12 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: LEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLV
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP61767 (Previous Catalog # AAPP48028)

Target Info

• Gene Symbol: BCL2L12
• Gene Full Name: BCL2-like 12 (proline rich)
• Alias Symbols: MGC120313, MGC120314, MGC120315
• NCBI Gene Id: 83596
• Protein Name: Bcl-2-like protein 12
• Description of Target: The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a Bcl-2 homology domain 2 (BH2). The function of this gene has not yet been determined. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
• Uniprot ID: Q9HB09
• Protein Accession #: NP_619580
• Nucleotide Accession #: NM_138639
• Protein Size (# AA): 334
• Molecular Weight: 37kDa
• Protein Interactions: UBC; SGTA; HSPA4; BCL2L1;