- Description of Target:
- Wasf2 is a downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. It promotes formation of actin filaments. Wasf2 is a part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex.
- Gene Symbol:
- Wasf2
- Official Gene Full Name:
- WAS protein family, member 2
- Alias Symbols:
- AW742646; D4Ertd13e; WAVE2
- Tissue Tool:
- Find tissues and cell lines supported to express Wasf2.
- Protein Accession# :
- NP_700472
- Nucleotide Accession#:
- NM_153423
- Swissprot Id:
- Q8BH43
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 497
- Molecular Weight:
- 55kDa
- Application:
- WB
- Partner Proteins:
- Baiap2, Prpf40a
- Immunogen:
- The immunogen for anti-Wasf2 antibody: synthetic peptide corresponding to a region of Mouse
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Wasf2 antibody - N-terminal region (ARP51323_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Dog: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-Wasf2 antibody
- ARP51323_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: ALKFYTNPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRK
- Blocking Peptide:
- For anti-Wasf2 antibody is Catalog # AAP51323 (Previous Catalog # AAPS23412)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Wasf2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
